PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9818613g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 129aa    MW: 15049.3 Da    PI: 10.4618
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9818613g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l +++k +G g+W   +++ g++R++k+c++rw++yl
  MA_9818613g0010 19 RGAWTANEDKILSEYIKTHGVGRWGDLPKKAGLRRCGKSCRLRWLNYL 66
                     89*********************************************7 PP

2Myb_DNA-binding569.2e-1872115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eEdellv+++++lG++ W++Ia +++  Rt++++k++w++
  MA_9818613g0010  72 RGNISPEEDELLVRLHRLLGNR-WSLIAGRLP-SRTDNEIKNYWNT 115
                      7999******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.9461466IPR017930Myb domain
SuperFamilySSF466892.13E-2917113IPR009057Homeodomain-like
SMARTSM007179.0E-121868IPR001005SANT/Myb domain
PfamPF002493.1E-141966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-232072IPR009057Homeodomain-like
CDDcd001672.36E-82166No hitNo description
PROSITE profilePS5129426.38467121IPR017930Myb domain
SMARTSM007172.0E-1671119IPR001005SANT/Myb domain
PfamPF002495.7E-1672116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2573121IPR009057Homeodomain-like
CDDcd001672.35E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MCRSPSCWSC SKHVDGLNRG AWTANEDKIL SEYIKTHGVG RWGDLPKKAG LRRCGKSCRL  60
RWLNYLRPDI KRGNISPEED ELLVRLHRLL GNRWSLIAGR LPSRTDNEIK NYWNTQLSKR  120
VQMGEFEPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8104400.0JF810440.1 Picea abies TT2-like protein mRNA, complete cds.
GenBankKU1312180.0KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008337875.13e-62PREDICTED: transcription factor MYB12 isoform X2
SwissprotQ9FJA28e-54TT2_ARATH; Transcription factor TT2
TrEMBLR4HES64e-89R4HES6_PICAB; TT2-like protein
STRINGGLYMA13G16890.11e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.15e-55MYB family protein